Loading...
Statistics

Mir Ginekologa | Центр женского Ð·Ð´Ð¾Ñ€Ð¾Ð²ÑŒÑ ...
www.mirginekologa.ru/
Advertisement

Mirginekologa.ru

Home Conversion Technology Metas Server
Mirginekologa.ru is hosted in Russian Federation . Mirginekologa.ru doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 5. First javascripts: Jquery.js, Jquery-migrate.min.js, Jquery.carouFre...-packed.js, Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: openresty/1.9.3.1. Its CMS is: Wordpress.

Technologies in use by Mirginekologa.ru

Technology

Number of occurences: 8
  • CSS
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 5
  • jquery.js
  • jquery-migrate.min.js
  • jquery.carouFredSel-6.2.1-packed.js
  • custom.js
  • skip-link-focus-fix.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • openresty/1.9.3.1

Powered by

  • PHP/5.6.23

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Mirginekologa.ru

Missing HTTPS protocol.

    Meta - Mirginekologa.ru

    Number of occurences: 3
    • Name:
      Content:
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: generator
      Content: WordPress 4.3.6

    Server / Hosting

    • IP: 91.106.207.14
    • Latitude: 55.75
    • Longitude: 37.62
    • Country: Russian Federation

    Rname

    • ns1.beget.pro
    • ns2.beget.pro
    • ns1.beget.com
    • ns2.beget.com
    • mx2.beget.ru
    • mx1.beget.ru

    Target

    • hostmaster.beget.com

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Server: openresty/1.9.3.1 Date: Sat, 01 Oct 2016 22:24:02 GMT Content-Type: text/html; charset=UTF-8 Content-Length: 0 X-Powered-By: PHP/5.6.23 X-Pingback: http://mirginekologa.ru/xmlrpc.php Location: http://mirginekologa.ru/ X-Cache: MISS from s_bd47 Via: 1.1 s_bd47 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Server: openresty/1.9.3.1 Date: Sat, 01 Oct 2016 22:24:03 GMT Content-Type: text/html; charset=UTF-8 Vary: Accept-Encoding X-Powered-By: PHP/5.6.23 X-Pingback: http://mirginekologa.ru/xmlrpc.php X-Cache: MISS from s_bd47 Transfer-Encoding: chunked Via: 1.1 s_bd47 (squid/3.5.20) Connection: keep-alive

    DNS

    host: mirginekologa.ru
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 91.106.207.14
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1.beget.pro
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2.beget.pro
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1.beget.com
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2.beget.com
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: ns1.beget.com
    5. rname: hostmaster.beget.com
    6. serial: 1467313978
    7. refresh: 300
    8. retry: 600
    9. expire: 86400
    10. minimum-ttl: 300
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 20
    5. target: mx2.beget.ru
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 600
    3. type: MX
    4. pri: 10
    5. target: mx1.beget.ru
    host: mirginekologa.ru
    1. class: IN
    2. ttl: 600
    3. type: TXT
    4. txt: v=spf1 redirect=beget.ru
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.irginekologa.ru, www.mpirginekologa.ru, www.pirginekologa.ru, www.moirginekologa.ru, www.oirginekologa.ru, www.miirginekologa.ru, www.iirginekologa.ru, www.mkirginekologa.ru, www.kirginekologa.ru, www.m.irginekologa.ru, www..irginekologa.ru, www.muirginekologa.ru, www.uirginekologa.ru, www.mjirginekologa.ru, www.jirginekologa.ru, www.mnirginekologa.ru, www.nirginekologa.ru, www.m-irginekologa.ru, www.-irginekologa.ru, www.mrginekologa.ru, www.mirrginekologa.ru, www.mrrginekologa.ru, www.mifrginekologa.ru, www.mfrginekologa.ru, www.mivrginekologa.ru, www.mvrginekologa.ru, www.mikrginekologa.ru, www.mkrginekologa.ru, www.mi,rginekologa.ru, www.m,rginekologa.ru, www.mibrginekologa.ru, www.mbrginekologa.ru, www.migrginekologa.ru, www.mgrginekologa.ru, www.mitrginekologa.ru, www.mtrginekologa.ru, www.miyrginekologa.ru, www.myrginekologa.ru, www.miurginekologa.ru, www.murginekologa.ru, www.mijrginekologa.ru, www.mjrginekologa.ru, www.mimrginekologa.ru, www.mmrginekologa.ru, www.minrginekologa.ru, www.mnrginekologa.ru, www.miginekologa.ru, www.miriginekologa.ru, www.miiginekologa.ru, www.miroginekologa.ru, www.mioginekologa.ru, www.mirlginekologa.ru, www.milginekologa.ru, www.mirlginekologa.ru, www.milginekologa.ru, www.mir.ginekologa.ru, www.mi.ginekologa.ru, www.mirinekologa.ru, www.mirgsinekologa.ru, www.mirsinekologa.ru, www.mirgxinekologa.ru, www.mirxinekologa.ru, www.mirgyinekologa.ru, www.miryinekologa.ru, www.mirghinekologa.ru, www.mirhinekologa.ru, www.mirgninekologa.ru, www.mirninekologa.ru, www.mirgcinekologa.ru, www.mircinekologa.ru, www.mirgdinekologa.ru, www.mirdinekologa.ru, www.mirgeinekologa.ru, www.mireinekologa.ru, www.mirgrinekologa.ru, www.mirrinekologa.ru, www.mirgtinekologa.ru, www.mirtinekologa.ru, www.mirgbinekologa.ru, www.mirbinekologa.ru, www.mirgvinekologa.ru, www.mirvinekologa.ru, www.mirgnekologa.ru, www.mirgirnekologa.ru, www.mirgrnekologa.ru, www.mirgifnekologa.ru, www.mirgfnekologa.ru, www.mirgivnekologa.ru, www.mirgvnekologa.ru, www.mirgiknekologa.ru, www.mirgknekologa.ru, www.mirgi,nekologa.ru, www.mirg,nekologa.ru, www.mirgibnekologa.ru, www.mirgbnekologa.ru, www.mirgignekologa.ru, www.mirggnekologa.ru, www.mirgitnekologa.ru, www.mirgtnekologa.ru, www.mirgiynekologa.ru, www.mirgynekologa.ru, www.mirgiunekologa.ru, www.mirgunekologa.ru, www.mirgijnekologa.ru, www.mirgjnekologa.ru, www.mirgimnekologa.ru, www.mirgmnekologa.ru, www.mirginnekologa.ru, www.mirgnnekologa.ru, www.mirgiekologa.ru, www.mirginnekologa.ru, www.mirginekologa.ru, www.mirginhekologa.ru, www.mirgihekologa.ru, www.mirginjekologa.ru, www.mirgijekologa.ru, www.mirginkekologa.ru, www.mirgikekologa.ru, www.mirginlekologa.ru, www.mirgilekologa.ru, www.mirgin ekologa.ru, www.mirgi ekologa.ru, www.mirginkologa.ru, www.mirginexkologa.ru, www.mirginxkologa.ru, www.mirgineskologa.ru, www.mirginskologa.ru, www.mirginewkologa.ru, www.mirginwkologa.ru, www.mirginerkologa.ru, www.mirginrkologa.ru, www.mirginefkologa.ru, www.mirginfkologa.ru, www.mirginevkologa.ru, www.mirginvkologa.ru, www.mirgineckologa.ru, www.mirginckologa.ru, www.mirgineqkologa.ru, www.mirginqkologa.ru, www.mirgineakologa.ru, www.mirginakologa.ru, www.mirgineykologa.ru, www.mirginykologa.ru, www.mirgineologa.ru, www.mirginektologa.ru, www.mirginetologa.ru, www.mirginekologa.ru, www.mirgineologa.ru, www.mirginekgologa.ru, www.mirginegologa.ru, www.mirginekbologa.ru, www.mirginebologa.ru, www.mirgineknologa.ru, www.mirginenologa.ru, www.mirginekhologa.ru, www.mirginehologa.ru, www.mirginekyologa.ru, www.mirgineyologa.ru, www.mirgineklologa.ru, www.mirginelologa.ru, www.mirginekoologa.ru, www.mirgineoologa.ru, www.mirginekuologa.ru, www.mirgineuologa.ru, www.mirginekiologa.ru, www.mirgineiologa.ru, www.mirginekmologa.ru, www.mirginemologa.ru,

    Other Reviews

    1. c-cbs.co.uk
      United Kingdom - 85.233.160.22
      Server software: Apache
      Technology: Html, Javascript, Php
      Number of meta tags: 1
    2. GTA-Universe.ru - Новости, моды, статьи GTA
      Новости Grand Theft Auto, Rockstar. Сборник лучших мировых модификаций и всегда обширная и пополняемая информация о GTA.
      Moscow (Russian Federation) - 193.109.246.55
      G Analytics ID: UA-45896238-1
      Server software: nginx/1.8.0
      Technology: Google Adsense, CSS, Google Font API, Html, Javascript, Yandex.Metrika, Google Analytics, LiveInternet counter
      Number of Javascript: 8
      Number of meta tags: 2
    3. موقع الحلول التكنولوجية
      Columbus (United States) - 98.130.42.2
      Server software:
      Technology: CSS, Html, Javascript, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 1
    4. MykonosButler.Com
      Denver (United States) - 108.174.149.9
      G Analytics ID: UA-64124776-1
      Server software: Apache
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Fancybox, Php, Pingback, SuperFish, Google Analytics, Wordpress
      Number of Javascript: 21
      Number of meta tags: 3
    5. Home Page
      Home Page
      Scottsdale (United States) - 97.74.210.129
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 4
    6. bjsywh.com
      Éý¿ÕÆøÇò,ÆøÇòӡ×Ö,À²À²°ô,³äÆø°ô--ʢԪÐ˴ïÎĻ¯Çìµ䴫ҥÓÐÏ޹«˾.רҵ´ÓÊÂÉý¿ÕÆøÇò,ÆøÇòӡ×Ö,À²À²°ô,³äÆø°ôµÄÉú²úºÍÏúÊۡ£Èç¹ûÄúÐèҪÉý¿ÕÆøÇò,ÆøÇòӡ×Ö,À²À²°ô,³äÆø°ô£¬ÇëÁªϵÎÒÃǡ£010-52383269
      Beijing (China) - 180.86.155.88
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Iframe, Swf Object
      Number of Javascript: 1
      Number of meta tags: 3
    7. Songs of Power and Prayer in the Columbia Plateau | The Jesuit, the Medicine Man, and the Indian Hymn Singer
      Corvallis (United States) - 128.193.164.143
      Server software: Apache/2.2.15 (CentOS)
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 9
      Number of meta tags: 3
    8. MICHIGANSPEEDINGTICKETLAWYER.COM | MICHIGANSPEEDINGTICKETLAWYER.COM
      Scottsdale (United States) - 166.62.28.82
      Server software: Apache/2.4.12
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 4
      Number of meta tags: 3
    9. ~~ Villa Spessartruh Weibersbrunn ~~ Gasthof ~ Pension ~ Biergarten ~~
      Gastronomie,Ãœbernachtung,Verpflegung
      Germany - 217.160.233.205
      Server software: Apache
      Technology: Html
      Number of meta tags: 12